PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 827aa    MW: 94989.8 Da    PI: 7.4861
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767066.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR188.41.1e-2767153291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e++     ++r+ ++++t+Cka+++vk+++dgkw+++++ ++HnHel p
  XP_009767066.1  67 FYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGVTPESDAG---TSRRPSVKKTDCKASMHVKRKRDGKWYIHEFIKDHNHELLP 153
                     9***************************************999888...7788899*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.9E-2567153IPR004330FAR1 DNA binding domain
PfamPF105514.4E-26273365IPR018289MULE transposase domain
PROSITE profilePS5096610.076553589IPR007527Zinc finger, SWIM-type
PfamPF044349.5E-6561586IPR007527Zinc finger, SWIM-type
SMARTSM005752.1E-8564591IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    Send to blast
MVDHGVVVQN SLQVIGDMVD AVDNTCHNRD GGVATSPKRS ITGVEGNADL EPRDGIEFES  60
HEAAYAFYQE YAKSMGFTTS IKNSRRSKKS KEFIDAKFAC SRYGVTPESD AGTSRRPSVK  120
KTDCKASMHV KRKRDGKWYI HEFIKDHNHE LLPALAYHFR IHRNVKLAEK NNIDILHAVS  180
ERTRKMYVEM SRQCGGSQEV GLLTNDLNYQ LDRGRCLSLE EGDAQVMLEY FMHIQRENPY  240
FFYAIDLNED QRLRNLFWID AKSRKDYVSF SDVVFFDTSY TKSNEKMPFV LFVGVNHHCQ  300
PMLLGCALVA DETKPTFVWL MKTWLRAVGG QAPKVMITDQ DKSLKAAIEE VFPCSRHCFA  360
LWHVLERIPD ILAHVVKQHE NFMEKFSKCI FKSVTDEQFD LRWWKMVSRF ELQENEWIHT  420
LYEERRKWVP AYMRGSFFAG MSTAQRSESI SSFFDKYIHK KISLKEFMRQ YGMILQNRYE  480
EEAVADFEIL QKHPALKSPS PWEKQMSTIY THAIFRKFQV EVLGVVGCHP KKEAENGETV  540
TFRVNDCEKN ENFMVTWNEA KSDVSCSCLL FEYKGFLCRH AMNVLQICGL PSIPSQYILK  600
RWTKDAKNRQ LLLEGTERIT RVQRYNDLCR RAIELGEEGS LSEESYGIAF RVLDEALKDC  660
VNVNNRSSTL TECSSSAIGL RDLEQDTQGI HATKTSRKKI TNKKRKVHTE PEAAIVEAQD  720
SLQQMDNLSV GGMTLNGYYG TQQNVQGLIQ LNLMEPPHDG YYVNQQNMQG LGQLNTIAPG  780
HDGFFGSQQS IPGLGHLDFR QPSFSYGLQE EPSLRASQLH GNSARHA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767065.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_009767066.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016495821.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495822.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495823.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495824.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495825.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495826.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
RefseqXP_016495827.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1-like isoform X1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLK4CKM90.0K4CKM9_SOLLC; Uncharacterized protein
STRINGSolyc08g060840.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein